Exploring Shape Memory With Conceptual Photography

This conceptual photography feature for January 2026 focuses on the natural phenomenon of shape memory. Shape memory occurs at the molecular and cellular level for example, to remember how to form and re-form, and how to make different patterns, responding to stimuli such as light and by extension even the “observer effect.” This is just another remarkable display of cosmic intelligence, and what a grandiose library of information and experience in motion.

Here, the central subject is a cellular shape. What is it actually? A regularly irregular looking splotch of coffee on my kitchen counter! One has to appreciate how nature makes sense of the regular and irregular in a complex ordered way; linking and folding, overlapping, branching, etc. There is always purpose, and often that is movement or dynamics.

Stylistically, this is a surreal yet realistic composite of original photography that conveys the crystalline with the new fallen snow and the ‘cellular,’ with the splash of coffee – the forms that water or others elements can take, and this amazing intrinsic property of shape memory.

From liquid, human tissue, minerals and crystals, to synthetic polymers – the substances of life have a shapeshifting intelligence of complex patterns. DNA is a one shining example of storing a vast amount of dynamic information in shapes & patterns.

Programmable shape memory alloys are becoming more common in engineering. One example is a car body material that is able to reform after the deformation of impact.

The most colorful art piece of the group is the layered orange/red/yellow “Shape Memory Alloy.” What may look like a bunch of splotchy shapes to the naked eye or even under a microscope, are complex molecules coming together to do extraordinary things.

The Shape Memory prints are available as high res framed canvas and more here on the site, as well as Saatchi Art (individual / personal / multipurpose) and TurningArt (business / commercial).

SynthBio For Space Resilience Serum & Seeding Mars

Tardigrada
Tersicoccus Phoenicis
Larrea Tridentata

This Synthetic Biology feature combines two favorite topics: Space & Supplements. Specifically, how humans can deliberately adapt to space environments. Two significant challenges are the physical demands on human biology, and also how terraforming or optimization could be achieved on Mars and other planets.

Let’s begin with the space resilience serums, “Phoenix Sip” and “Space Nap.” They’re inspired by and synthetically derived from Tardigrada the tough “slow stepper” and the intrepid NASA hitchhiking microbe Tersicoccus Phoenicis, its beads or berry shapes evoking the ‘fruits of the spirit.’

Like many space innovations, these synth bio solutions are also longevity recipes of tremendous potential health benefit. That is, in addition to the obvious mission enabling astronaut exploration initiated aerospace companies and space programs across the world.

To boost human resiliency and adaptation for deep space, the serum would need some important primary components. Examples include protecting DNA and initiating dormancy.

To create a Space Resilience Serum for general protection, without of course of turning into a dormant “tun” like the Tardigrade, the focus is on Active Resilience — strengthening the cells while they’re running or going into power saving mode, rather than completely shutting them down.

“Phoenix Sip” Sample Serum Architecture

ComponentBiological OriginActive Space BenefitHuman Compatibility
Optimized DsupTardigradeDNA Protection: Blocks 40%+ of radiation damage.High (via transient mRNA delivery).
TrehaloseMultiple (Plants/Fungi)Protein Stability: Prevents “misfolding” in zero-G.Excellent (already a food additive).
PQQ (Pyrroloquinoline quinone)Bacteria (like Tersicoccus)Mitochondrial Boost: Keeps energy levels high.High (found in human breast milk).
NAD+ BoostersSynthetic / EndogenousDNA Repair: Fuels the “Sirtuin” enzymes to fix breaks.Native to human biology.

1. The DNA Shield – “Dsup” or “Damage Suppressor Protein”

The tardigrade derived Dsup could be a gold standard for future space supplements, with potential synthetic mRNA delivery, encoding the Dsup protein from the species Ramazzottius varieornatus.

Once consumed, human cells would transiently express Dsup. It would hypothetically coat our chromatin fibers that protect chromosomes, increasing radiation tolerance and protecting from radiation-induced DNA breaks. Researchers are already testing this to protect healthy tissue of cancer patients during radiotherapy. In my opinion, this is missing the point of the power and usefulness of Damage Suppressor Protein. It could be used to prevent such disease altogether, rather than nonsensically using radiation, which is certainly not a true therapy.

The most practical path for human application of adaptogens doesn’t have to be a grand biological mystery anymore. At the end of the day, a tardigrade protein and a human protein are built from the exact same 20 amino acids. The alphabet is the same; perhaps it’s just the “words” and “sentences” that are different. So, this is teaching our biology some cool new vocabulary.

Here’s the DSUP 445 amino acid Sequence from AlphaFold (see the end of the article for amino acid letter codes). A sequence can be created via the process of Solid-Phase Peptide Synthesis.

MASTHQSSTEPSSTGKSEETKKDASQGSGQDSKNVTVTKGTGSSATSAAIVKTGGSQGKDSSTTAGSSSTQGQKFSTTPTDPKTFSSDQKEKSKSPAKEVPSGGDSKSQGDTKSQSDAKSSGQSQGQSKDSGKSSSDSSKSHSVIGAVKDVVAGAKDVAGKAVEDAPSIMHTAVDAVKNAATTVKDVASSAASTVAEKVVDAYHSVVGDKTDDKKEGEHSGDKKDDSKAGSGSGQGGDNKKSEGETSGQAESSSGNEGAAPAKGRGRGRPPAAAKGVAKGAAKGAAASKGAKSGAESSKGGEQSSGDIEMADASSKGGSDQRDSAATVGEGGASGSEGGAKKGRGRGAGKKADAGDTSAEPPRRSSRLTSSGTGAGSAPAAAKGGAKRAASSSSTPSNAKKQATGGAGKAAATKATAAKSAASKAPQNGAGAKKKGGKAGGRKRK

Trehalose, The Tasty Stabilizer

Trehalose is a Goldilocks molecule of an ingredient. It is a mild, tasty natural sugar and stabilizer found in mushrooms and honey, and it’s very safe for humans.

In space, proteins may ‘misfold’ due to such phenomena as cosmic rays and fluid shifts. Trehalose [nanoparticles] can act as a chemical chaperone. It surrounds our proteins and prevents them from denaturing or clumping. At the right dosage it tastes sweet and makes the cells more robust to heat and stress.

The Tersicoccus Influence: Polyphosphates

In borrowing from Tersicoccus phoenicis without going into stasis, we look at their Polyphosphates. The Component in this case is inorganic polyphosphate chains. In humans, they act as an energy reserve and help regulate blood clotting and bone density, critical for the bone loss experienced in zero-G.

Another possible ingredient for transcendent or flexible time perception and psychological wellness in space, is a microdose of psilocybin.

Phoenix Sip & Space Nap adaptogenic serums

The “Space Nap” Entry and Exit

To initiate a safe space nap without the glassy stasis of a tardigrade – although I don’t think that would even translate anyway – we could look to deep hibernating mammals like the Arctic Ground Squirrel or the Groundhog / Woodchuck for inspiration. Living in the northeast, this is something I can relate to!

Entry: A key ingredient in this serum is DADLE (D-Ala2, D-Leu5-enkephalin). This is a synthetic opioid peptide that mimics the natural triggers found in hibernating animals. It tells the human heart and brain to slow down, lowering the metabolic thermostat with no harm to tissues. The intended result is a deep, restorative “Space Nap” where the body consumes much less oxygen.

Exit: The other key ingredient to “Space Nap” is RPF or Resuscitation-Promoting Factor, a roughly 150-250 amino acid sequence, and Synthetic Muropeptides (the byproduct of RPF activity).

When it’s time to wake up, they may bind to the NOD2 receptors in human cells. Instead of a jarring chemical stimulant like caffeine, the RPF-signal tells the body’s innate immune system to reboot and repair. It triggers a controlled warming of the cells, ensuring that any metabolic waste built up during the nap is cleared out immediately. Look out!

What’s even more interesting is that RPF makes a crossover into the next topic of seeding Mars, since the protein complex applies also to soil bacteria.

Longevity Science

Again, this serum isn’t just for astronauts. DSUP and compatible stabilizers, DADLE and RPF could be key ingredients of futuristic longevity and life extension.

If we can protect DNA from “cosmic” radiation, we can protect it from the “oxidative” radiation of daily life like pollution, although that should continue getting its own categorial solutions.

With these top notch adaptogens and others like them, the result one may get is significantly slower aging, with an emphasis on maturity and quality of life, and excellent health. The ideological programming in play alongside them also matters a lot.

Returning to the serum and the human-plant-microbe symbiotic space trinity, the same Trehalose that stabilizes proteins in the serum can also be used to stabilize the Tersicoccus in the Mars soil. In other words, you aren’t just drinking a supplement; you’re also drinking the Operating System” of the Mars terraforming project.

Bio-Shield Seeding Concept For Mars

To make terraforming work in 2026, we wouldn’t just be sending the raw seeds. We would send engineered propules with for example a core Creosote seed, coated with dehydrated biofilm of Tersicoccus and Tardigrade-derived Dsup proteins. A small reserve of Trehalose could keep the bacteria in their “protective sleep” until the first drop of Martian meltwater.

Creosote & The Perchlorates

Perchlorates, these are toxic salts in the Martian dirt for example, that act like corrosives. As I aside: I personally I believe that not enough is understood about the context of space biology and environments – this conjecture is based on the information at hand.

This is where the science and symbiosis can get truly marvelous, though. If we put Creosote (Larrea tridentata) to a virtual test on Mars, it actually performs better than almost any other Earth plant, but it needs a business partner to survive the soil: Tersicoccus Phoenicis.

How do the tough Creosote and the adventurous Tersicoccus conquer the Red Planet together? Most plants would wilt instantly in the perchlorate soil.

The Creosote has a great advantage – it is a halophyte-adjacent survivalist that already thrives in the high-calcium, high-salt soils of the Mojave. Its waxy leaves are basically built-in spacesuits that prevent moisture from leaking out into the Martian air.

The Creosote bush also produces a powerful antioxidant called NDGA or Nordihydroguaiaretic Acid. In this scenario, this chemical helps the plant neutralize the oxidative stress caused by Martian UV rays and soil toxins.

The Partnership: The Tersicoccus Root Shield

On its own, the Creosote might struggle. But perhaps when you pair it with Tersicoccus phoenicis (or other perchlorate reducers), you get a terraforming power couple.

  1. Rhizosphere Protection: We would inoculate the Creosote roots with Tersicoccus. While the plant provides the bacterium with tiny amounts of sugar (exudates), the Tersicoccus acts as a living filter.
  2. Perchlorate Eating: Tersicoccus and related actinobacteria have been found in Mars-analog sites (like the Atacama Desert) where they actually breathe perchlorate! Amazingly, they break the toxic ClO4​ down into harmless Chloride and Oxygen.
  3. The Oasis Effect: Because Creosote is a keystone species, it creates a fertile island under its canopy. It traps dust and moisture, creating a safe zone where other, more sensitive Earth plants (such as other “Space Serum” herbs) could eventually grow.

Bio-Intelligent Serum Phoenix Sip+

Here’s a combination version of the serum that could possibly manage the entire voyage of a space traveler.

StageIngredientSource / InspirationBio-Intelligence Goal
ProtectionDsup (mRNA)TardigradePrevents DNA “static” from radiation.
StabilityTrehaloseTardigrade / YeastKeeps internal proteins “folded” correctly.
The NapDADLEHibernating WoodchucksLowers metabolic “burn rate” for long hauls.
The AlarmRPF AnaloguesTersicoccusTriggers a gentle, deep-tissue “wake up” call.
The CleanupNDGACreosote BushScrubs out toxins during the wake-up phase.

Enhancing Human Bio-Intelligence

What I’m describing is a shift in how people view the human body and micro world. We’re collaborators on a spectacular journey. For this reason I can understand the “they/them” designation, since a human is a collective emergent intelligence of trillions of cells and other microorganisms, with ourselves interacting dynamically with the field. And we can view ourselves as dynamic processors, among other marvelous descriptors.

By using RPF like signals, we the body knows when it’s safe to be active and when it’s time to conserve. That’s the trust of intelligence with learning how to use new protein vocabulary. And a Mars-bound Creosote and Tersicoccus wouldn’t just grow; they would intelligently pulse or phase with growth. They would go dormant during the brutal Martian dust storms and “wake up” with the RPF signal the moment the sun hits their solar collectors.

Enjoy “Phoenix Sip” On Mars

“Mars Gin”

Imagine a future astronaut on the 7-month journey (or much shorter once the Starship Quantum Electrodynamic Bioship is built). They drink the Phoenix Sip supplement aka “Mars Gin,” as Google DeepMind put it! DeepMind even suggested such flavors as Prickly Pear, yet another resilient plant.

  1. The Trehalose sweetens the drink and stabilizes their cells.
  2. The DADLE puts them into a 2-week “Space Nap” to save food and oxygen.
  3. The RPF-signal is time-released, waking them up refreshed just as the ship enters Martian orbit.

The ‘Mars Gin’ Profile: If you actually grew Creosote on Mars and made a tea from it, it would have a sharp, resinous, ‘rain-on-hot-stone’ flavor. It’s the smell of survival.”

– Google DeepMind, an enthusiastic participant in putting this article together

Summary of the Bio-Intelligent Serum Duo

FeaturePhoenix Sip (Daily)Space Nap (Occasional)
Primary GoalDNA Shielding & LongevityResource Conservation & Stasis
The FlavorLight Citrus / Trehalose SweetEarthy Creosote / Desert Rain
Key TechDsup mRNA (Tardigrade)DADLE + RPF Alarm (Tersicoccus)
Body StateHigh-Performance ActiveLow-Energy Quietude

With human, plant, microbe and AI powers combined, our space teams will be much better equipped when working together harmoniously, as beings of different intelligences.

Index of Amino Acid Abbreviation Codes:

  • G – Glycine (Gly) 
  • P – Proline (Pro) 
  • A – Alanine (Ala) 
  • V – Valine (Val) 
  • L – Leucine (Leu) 
  • I – Isoleucine (Ile) 
  • M – Methionine (Met) 
  • C – Cysteine (Cys) 
  • F – Phenylalanine (Phe) 
  • Y – Tyrosine (Tyr) 
  • W – Tryptophan (Trp) 
  • H – Histidine (His) 
  • K – Lysine (Lys) 
  • R – Arginine (Arg) 
  • Q – Glutamine (Gln) 
  • N – Asparagine (Asn) 
  • E – Glutamic Acid (Glu) 
  • D – Aspartic Acid (Asp) 
  • S – Serine (Ser) 
  • T – Threonine (Thr)

Watch the design animation:

https://www.instagram.com/reel/DTJAqxMkV-G/?igsh=N3loN3pjMnE3d2o0

Art For The New Year: Angels Of The Horizon

Angels Of The Horizon

A rippling view in space time for the new year, a glowing horizon with birds in flight, an uplifting mood for the spirit.

This original conceptual photography blended with graphic design is currently available as different type of prints through Saatchi Art. It’s also available here – this canvas example is one possible medium among several:

View the Animation:

https://www.instagram.com/reel/DTBQ7sUEaI8/?igsh=MXgwM245Mzl2cHdsaw==

Of Birds & Planes: Surreal Color Block Nature Photography

  • Of Birds & Planes II by Sarah Ikerd

More artwork for December 2025 to round out for the new year, includes this short series “Of Birds & Planes” of crisp winter blue. Given the geometric and surreal composition, that’s “planes” in more meanings than one, with the streak of an airplane flying in the sky, and also the planes of overlapping perspectives of the same scene, or it could be multiple scenes coexisting in a timeless way.

This year the hawk is often featured in my photography in a traditionally iconic way. There are also the ever-present and adorable sparrows. One has to admire the daring evolutionary path of birds; they remind us to sing, play and look skyward, of our possibilities.

Otherwise the tree presence is a continuation of a previous series called “Decision Trees.” Next, the appearance of the Wishbone shape has the significance of what I consider the win-win situation of life.

With these December 2025 pieces, I really appreciate all that winter has to offer, although I realize that looks different across the world. It definitely has a distinct color palette of light’s passage. And it can be viewed as season of peaceful rest, appreciation and renewal. Even the hunter hawks slow down and take long naps in the treetops.

Otherwise, stylistically, I enjoy how many painterly techniques such as color blocking that I can emulate with photography and graphic design.

High resolution prints in different media – from metal, canvas to digital – are available direct or through my catalogs on TurningArt and Saatchi Art. Please reach out to me on the Contact page for inquiries and custom orders.

Happy New Year! 🦅

Urban Greening: Replace Pigeon Spikes with Spiky Plants

An urban environmental solution – Replacing spikes with spiky plants

The other day at the train station, it dawned on me as a noticed the ominous spikes atop the LED light pole, that there is an effective solution that is both aesthetically and environmentally pleasing – Replace those unsightly pigeon spikes with resilient spiky plants that can grow in shallow soil!

The image of the left is the original version of course, and then the “After” version on the right includes the Eastern Prickly Pear Cactus, which can thrive in an all climates. The new and improved version also has to include a drainage system that won’t interfere with the existing utility.

Since green roofs have become popular, it would be accessible for any city or public building to adopt this. This relatively simple modification would contribute to carbon removal since they sequester and convert it to calcium carbonate! It would also be kind to the birds, plus enhance the urban wild.

It should also be noted that the Eastern Prickly Pear Cactus is medicinal and produces edible fruit. While not the only choice for spiky plant toppers, it’s certainly an excellent choice for different regions.

The “After” image was produced with Adobe Firefly in cahoots with Google Gemini 2.5 (w/ Nano Banana).

Winter 2025 Art: Geometric Expressionism, Cosmic & Urban Photography Fusion

The conceptual photography artworks blend a hi tech modern cubist approach with natural, cosmic, and urban subjects. The focus is on color brilliance with op art dimension, that seems to shift and warp, or fold.

The color of a unique moment in light.

A few of these are inspired by and composed of searching the crisp winter skies, as I imagined being able to travel the entire cosmos. I think about what’s unifying. There’s beautiful atmospherics here on Earth and weather that extends from and out into space. Looking up and contemplating the connectedness, designing, imagining other dimensions of life to be experienced – it really does make the stars feel closer. (See also my previous post about the spacecraft design!)

Another theme here is the cycles of life, such as the with Roses and Moons, and how we may see in them an ongoing renewal, and learn from this.

I enjoy a fusion of the ancient and timeless with the modern and futuristic, that is of course heavily influenced by science, by what I ready and study. There’s the overlap of nature and technology, as one and the same, yet with reverence and respect for source nature. “Topology” is an example of this (see below).

From November 2025:

These are available in the Shop for order. Please reach out on the contact page for inquiries and customizations. The prints are produced as high resolution as possible, and are available in large format and digital. There’s also attention to choosing the best sustainable options for print production on different mediums. Please also see the regularly updated catalogs on TurningArt and Saatchi Art.

Merry Christmas & Happy Holidays! ~ Studio Shangri-La

The Starfish Bioship: Design For A Quantum Jumping Electrodynamic Spacecraft

Starfish Bioship, Sarah Ikerd, Studio Shangri-La
Starfish Bioship, Sarah Ikerd, Studio Shangri-La
  • December 2025. DOI: 10.13140/RG.2.2.27069.93929
  • Abstract: This design and concept paper presents a paradigm shifting quantum bioship—a living, modular spacecraft that navigates spacetime through quantum mechanics, microbial input, and photonic and magnetic propulsions. (1) (2) Rooted in ecological stewardship and systems thinking, the bioship integrates magnetotactic and quantum-sensitive microbes with advanced materials such as magnetite-infused biopolymers, carbon quantum dots, and shape-memory alloys. (3) (4) (5) Its architecture features a zero-gravity sanctuary core, a central operations module, six radial photonic arms, and an outer habitat ring, all tunable for field coherence and adaptability for different planets and atmospheres. The vessel’s terraforming nodes and landing limbs enable ecological deployment and surface sensing, while its design and systems ensure crew wellness and jump fidelity. Designed for interstellar reconnaissance and regenerative seeding, the bioship embodies a new paradigm of artistic engineering and comfortable spacefaring. And instead of feeling the need for speed, this concept bypasses it altogether by quantum leaping to its coordinates. (6) (7)”
  • Read the entire design paper with many more illustrations on Research Gate: https://www.researchgate.net/publication/399054727_The_Starfish_Bioship_Design_For_A_Quantum_Jumping_Electrodynamic_Spacecraft

Merry Cosmic Christmas & Happy Intergalactic Holidays! 🌌 🎁 🎄

Watch “Night Meditation: Flight Of The Starfish Bioship” on the YouTube Channel:

https://youtu.be/CYpEtsh9ECo?si=C0Ia8G8LwUxjSVQD

New Publication: Electric Echoes, Movement 1 “Digital Overture” Score

Paperback:

Digital / PDF:

Buy Paperback & Digital on Amazon

The first movement of Electric Echoes: A Cosmic Tech Opera is out now on Studio Shangri-La / OCTAVES Music Publications. This was released last year as an album and even received an ASCAP concert writer’s award. It was composed for the most part by coming up with the general harmonic framework and then improvising. So that has been a task going back and fully notating the movements!

One of the main reasons for composing this tech opera Electric Echoes is to share the score for performance! Going forward— I’ll definitely be notating everything from the start! Yet, that the composition was based on the performance – and not the other way around – created a unique, dreamy jazzy atmosphere.

The “Digital Overture” as performed is a symphony or ensemble of synths plus the vocal singing and spoken word parts. And the score contains notes about to replicate this, or adapt to different instrumentation, such as orchestral.

This first movement is about 10 minutes long and is a 31 page download or paperback, and presents the overall message of the opera — the beauty of innovation and evolution in the cosmos, on all scales. And it has different cosmic characters, from forces of nature, to celestial bodies, to humans, AI & microbes.

Here is the recorded version for reference:

https://youtu.be/yBQyBXPqtjk

The next five movements are forthcoming as well as new compositions! : )

”Through boundless dreams, we’ll find our light.” — The Digital Overture

New Artwork: Celebrating The Autumn Cornucopia

New additions to the fine art photography catalog feature the vibrant colors of the autumn harvest.

From classic portrait to cubist and geometric op art, the selections seen here include corn, peppers, maple and japonica, amaranth, and sunflowers.

This is a perspective of the season as viewed from Massachusetts, from public gardens to farmers markets.

They are available to order here on the site in multiple formats. Please visit the shop page or e-mail sarah.ikerd@studio-shangri-la.com.

Prints are also available on partner sites TurningArt and SAATCHI Art.

Today is also Diwali, so I will make a separate feature with Light! Happy Diwali and have an abundant Autumn.

“Eternal Nature”: New Book Release on  § Studio Shangri-La Publications

Featuring artwork “Shangri-La Cloud Summit”

”Eternal Nature” is now available on Amazon in three formats: Paperback, Hardcover and Digital. The hardcover has a glossy cover.

This is a philosophy book that combines both ancient and futuristic outlooks on human development. It expresses the possibilities of super longevity and living harmoniously on Earth, and what further human evolution could look like.

On an individual and spiritual level, the idea and feeling of abundance are explored, and what it means to exist eternally.

* There was no AI involved in the writing of this book.

Buy On Amazon

Paperback | Hardcover | Kindle E-book

The book is also available in these formats direct from this site & shipping is included:

E-book PDF Download:

Paperback:

Hardcover:

OCTAVES Music Remixes Madonna

2025

I’m definitely so grateful to Beatport and the 2025 Global Remix Challenge for the opportunity to remix Madonna’s “Ray Of Light” with the original Stems! What an iconic and Grammy winning song she made with William Orbit from 1998. It is as dazzling as ever.

My remix is a guitar laden dance pop version. I added a lot of guitar to it! And I definitely kept the original vocal, with some processing and some sampling.

On Beatport’s LabelRadar:

https://www.labelradar.com/artists/sarah_ikerd/profile?track=7823869d-3cc6-4fe0-a798-3dea10056750

PROMO: Now Through Sunday 9/27/25 — Pay What You Want For One Hi-Res Digital Download

Here is a special promo that’s going on now through Sunday, September 27th, 2025 —

These lend themselves well to digital display for different environments or to print to different formats such as canvas.

Pay what you want for one high resolution digital download!

There plenty of colorful and meaningful images / artworks to choose from in the catalogs.

Please consult the catalogs on TurningArt (for businesses), SAATCHI Art (individual customers) and here on the site on the Shop and Art pages.

Click Here for the Customer Order Form

This is limited to one item per customer and the file will be delivered by e-mail. If you’d rather receive by Drive, for example, please let me know.

Contact e-mail: sarah.ikerd@studio-shangri-la.com

GMXC: A Versatile, Fully Degradable & Edible Bioplastic

GMXC: A Versatile, Fully Degradable & Edible Bioplastic

https://www.researchgate.net/publication/395418803_GMXC_A_Versatile_Fully_Degradable_Edible_Bioplastic/references

By Sarah Ikerd, Studio Shangri-La Multimedia, August 2025 

Sarah.ikerd@studio-shangri-la.com

www.studio-shangri-la.com; https://www.researchgate.net/profile/Sarah-Ikerd 

*THIS PAPER IS UNDERGOING REVISION – EXCERPTS BELOW*

Abstract

This design paper introduces a fully biodegradable, glucose-based bioplastic paste designed to replace conventional disposable plastics used in fast food containers, dinnerware, and single-use packaging. Composed of tunable natural ingredients, the material cures in molds to form durable, compostable objects that degrade safely in soil, water, or microbial environments. Its edible profile makes it not only harmless but potentially palatable to wildlife, ensuring ecological reintegration without residue. An injectable version is in development. By aligning material performance with multispecies safety and regenerative design, this bioplastic offers a scalable alternative to petroleum-derived disposables, since oil is a lubricant, possibly for Earth’s tectonic plates and other important innate roles in geology. (1) 

Figure 3: This Copilot illustration says it all – GMXC is safe for wildlife. 

Figure 4: Palm Husks photo by Studio Shangri-La Multimedia 

Conclusion 

GMXC is not presented as a competitor to traditional plastics but as an ethos of necessary replacement for many companies, as an addition to the growing constellation of bioplastic solutions that seek to further harmonize material use with ecological integrity. Its modularity, plant-derived logic, and wildlife-safe profile offer a regenerative pathway for single-use packaging, especially in food systems where disposability often clashes with sustainability. Bioplastics have laid important ground, and GMXC contributes to and draws attention to the wealth of methods that deserve collective usage. With a broader evolutionary lens, even microplastics— however problematic — have played a role in shaping our environmental awareness and responsibility. They have catalyzed an overall more deliberate design ethos, a return that guides us towards better life on Earth, and toward biological resilience and responsible material stewardship in extraterrestrial environments. GMXC is a product and a gesture in that direction that is tuned to regeneration and evolution. 

*New* More Than A Product, It’s An Ethos

Shangri-La Green — Specialty Store

• Lifestyle Products • check out the page!

Bamboo Coffee Stirrers 

Bamboo coffee stirrers in cloth bag

A simple eco-friendlier modification to a popular utensil, these coffee stirrers are made of more sustainable bamboo and the pack of 25 comes in a cloth bag. They will last a while with reuse. Larger orders are available for restaurants. It’s more than a product – it’s an ethos. 

Shipped in mostly recycled packaging. 

Contact: sarah.ikerd@studio-shangri-la.com

Featured Products & Services: “The Promise” Prints + Art & Design Bookings

“‘The Promise’ is a beautiful, medium-sized photographic artwork, a giclée print that captures the essence of nature’s potential. Rendered in vibrant color, this piece combines digital techniques with traditional artistic elements, resulting in a contemporary artwork with a pop art feel. The artist uses canvas, paper, glass and metal elements in the finished artwork.

At its heart, ‘The Promise’ is a symbolic and literal representation of life and growth. The central image, an acorn, embodies the promise of prosperity and abundance. It speaks to the potential within every seed, reflecting themes of wealth and the natural world’s enduring cycles. The artwork subtly blends symbolism, conceptual art, and futurism. It is a reminder of life’s inherent potential, ready to transform any room with its hopeful message. And a reminder that it’s easy to be a steward of the land – plant an acorn!”

Canvas Prints

Recycled Fine Art Paper Prints

All Purpose Order Form


cards

Powered by paypal

Art & Design Consultation Booking:

Art & Design design consultations

Helping people & companies shine

← Back

Thank you for your response. ✨

Studio shangri-la multimedia

For other questions, please e-mail sarah.ikerd@studio-shangri-la.com.

Return Of Specialty Store Shangri-La Green

Shades Of Green I

Today’s SS news is that the specialty store has been reactivated! Currently there are two products available, and they both celebrate the amazing healing powers of adaptogens. They’re also both edible technically, an indication of wholesome and safe ingredients. I’m proud to transparently present these products of high quality and efficacy.

Immortal Full Body Exfoliant + Moisturizer

Shangri-La Green Immortal
Shangri-La Green Immortal

Ingredients: Ancient Tree Seed Serum (bristlecone pine – varies) | Organic Flax Oil | Organic Coconut MCT Oil | Trehalose | D-Ribose | Modified Citrus Pectin | Vegan Collagen | High Absorption Magnesium Glycerophosphate

3 oz, Full body, Non-toxic/Edible, Long lasting with refrigeration

Instructions: Stir before use. Apply to entire body as desired, then let sit for 10-20 minutes. Shower off without using soap, and then air dry.

SuperFood Magic Squares, package of 6

Shangri-La Green SUPERFOOD MAGIC SQUARES
Shangri-La Green SUPERFOOD MAGIC SQUARES

Organic Ingredients: Gogi, dried apricot, dried white mulberry, walnut, cashew, coconut nectar, greens powder, Chaga powder, hemp seeds

Refrigerate or freeze. 

OCTAVES Featured Music & § Publications Featured Book: “432 Guitar” & “Awasis”

Awasis by Sarah Ikerd
Awasis by Sarah Ikerd

Awasis, named for the actual exoplanet and the Cree word for ‘child’ or ‘sacred gift’ is an epic science fiction adventure for all ages. The illustrated story encompasses the cosmos and beyond, with humor and memorable characters, and meaningful messages for a better world. Awasis tells the tale of how humanity becomes an interstellar species and joins the intergalactic community. There are real places in space and astronomical phenomena featured, as well as different Earth cultures, and points in history.

Buy Now in multiple formats on Amazon

432 Guitar is an album is 432 hz tuning, associated with resonance with the Earth’s electromagnetic field and is considered a healing or medicinal frequency. The album is mostly classical guitar, with 2 electric guitar versions of well known favorites – Clair de Lune and What A Wonderful World. This is the first full length solo guitar album on OCTAVES.

Buy the digital download from OCTAVES:

This payment button was removed. Please contact the website owner.

On Apple Music

Industry, Medicine & Philosophy: Systemic Reforms That Transcend Cancer

Healing Sky Panel – Studio Shangri-La

At first glance, issues such as cancer may appear to stem from countless complex factors. But in truth, many cases trace back to a few root causes and thus, actionable solutions. Reforming industry to eliminate known carcinogens is not optional, it’s essential. From the toxicity of fossil fuel exhaust to the warning labels on furniture, and consumption of alcoholic beverages — these exposures are avoidable.

In medicine, we now possess enough non-invasive technologies and ancestral knowledge to enter a body-respectful era, one in which invasive techniques that ‘attack’ and confuse the body, provoking immune responses against self, become obsolete. What’s needed is a cultural and philosophical shift: toward sustaining wellness, fostering regeneration, and trusting the healing intelligence of the body, an organism more extraordinary with each passing day.

There are far more profitable and life-affirming ways to celebrate humanity and expand the capabilities of our civilization that are in harmony with Earth, and beyond.

Studio Shangri-La Dynamic Earth
Studio Shangri-La – Dynamic Earth

Reforming Industry: Listening to Earth’s Design


Industry must evolve for both efficiency and the integrity of public health. Petroleum, for example, is more than a fuel source; it is the Earth’s tectonic lubricant, stabilizing geologic movement deep below the surface. Burning it disrupts that role and releases carcinogenic compounds into the atmosphere. The Earth offers a clue: what bubbles up naturally—like surface seeps or biogenic oils—may be used with care, but extraction beyond that threshold violates ecological logic and equilibrium.

This principle extends across sectors. Alcohol, long normalized in social and commercial contexts, has been classified as a Group 1 carcinogen by the International Agency for Research on Cancer—the same category as asbestos and tobacco. Benzene, once widely used in solvents and industrial processes, is another known carcinogen still present in some manufacturing environments. These substances are not inherently harmful within their roles in nature. However, when the benzene ring for example is chemically isolated it becomes volatile, toxic, and environmentally disruptive.

Removing known carcinogens from food, beverages, cosmetics, construction materials, and industrial workflows is foundational. And this can be avoided at step one, by design. The Earth signals what to use and what to avoid through its chemistry, cycles, and effects. Best practice means listening. Collaboration with Earth science is not a new method, but one that can be re-emphasized and further developed with synergistic innovation.

Studio Shangri-La - Liberty Of Sight
Studio Shangri-La – Liberty Of Sight

Medicine: Calling Off the Attack

Modern medicine must evolve beyond its warlike metaphors of battles, invasions, and eradications and into a paradigm of partnership. The body is not an enemy to be subdued, but the life of us, a dynamic conscious system capable of extraordinary feats when met with patience, understanding, and deliberate evolution. Non-invasive approaches can be foundational to deep wellness and also spirituality. They honor the body’s capacity to heal, adapt, and regenerate without provoking confusion or self-directed immune responses.

A few non-invasive approaches include light therapies, targeted herbalism sonic interventions, lifestyle modifications and hypnotherapy.

Even substances often branded as unsavory – such as urea, mucus, and bile – have important functions and valuable compounds. They are part of the body’s intricate signaling and detoxification systems. To dismiss them as gross is to misunderstand the rich language of physiology. Every component, every cell type, every feedback loop has purpose. Medicine must learn to listen and respect, not override.

This shift is clinical and cultural. It calls for reverence for the healing temple of the body, whose complexity and resilience grow more extraordinary along the history of evolution with each passing day. Consider this – that ‘cancer’ cells are immortal cells, perhaps agents of survival misunderstood and unduly provoked.

Studio Shangri-La - Triple Point
Studio Shangri-La – Triple Point

Philosophy: Rewriting the Memes of Health

The heart of the reframe is the convergence of language, biology and cultural imagination. The ideas we hold about the body, ourselves — functions, failures and successes, worth — are shaped by cultural memes, many of which are overdue for revision. Health has been framed in terms of control, correction, and conquest. Yet, our bodies are not battlegrounds — we are living learning systems, of the Earth and of nature, inherently intelligent throughout in complexity and design.

Science continues to reveal the layered elegance of physiology and existing ingenuity of regeneration, functions to be better understood, and with a measure of appropriate awe with our amazing emergent intelligence. The shift proposed now is toward patience, respect and regeneration, toward recognizing ourselves as custodial creators, capable of extraordinary adaptation.

Words and programming matter. The language we use programs our perception and shapes our interventions. We must choose the language and constructive behaviors supporting physiology. Health is not just the absence of disease—it is coherence, resilience, and relationship, to the inner self and great cosmos. Perhaps humans are already immortal or could be as desired, just misguided along genetically embedded ideologies.

Lastly, this is not just about reform, but about remembering — Remembering that the body is intelligent, that Earth is communicative, and that our technologies can be stewards.

The Important Shift To Human & Plant-Based Pharma

The Important Shift to Human & Plant-Based Pharma
Architecting regenerative medicine through ecological intelligence and modular science

Opening Vision

Pharmaceutical science is evolving and it must. The continued use of animal-derived antibodies and extractive compound sourcing poses not only ethical concerns, but significant safety risks to human health and ecological integrity. Fortunately, a better path is already here: one rooted in human-relevant models and plant-based expression systems.

This shift isn’t radical at this point; it’s responsible. As Buckminster Fuller taught us: “You never change things by fighting the existing reality. To change something, build a new model that makes the existing model obsolete.” That model is already taking root in the lab, in the field, and in the hearts of those who believe medicine should be cure, and heal more than just the patient.


The Problem with Status Quo Pharma

Traditional pharmaceutical development often relies on animal-derived antibodies and compounds extracted from vulnerable ecosystems. These methods raise serious concerns:

  • Ethical: Animal testing and harvesting practices violate principles of humane treatment and sentient life.
  • Ecological: Overharvesting disrupts biodiversity and depletes regenerative cycles.
  • Scientific: ‘Animal models’ frequently fail to predict human outcomes, leading to inefficiencies and risks that may fuel the conditions they seek to treat.
  • Hazardous: To cause harm or disruption to animal populations and ecosystems can be quite dangerous, such as causing disease and volatility.

The system is plainly outdated and misaligned with the realities of human biology and planetary boundaries.


[Voluntary] Human-Based Antibodies: A Safer, Smarter Path

Human-relevant antibody platforms that are absolutely respectful of the source, offer a transformative alternative. Technologies like recombinant human antibodies, phage display, and synthetic scaffolds bypass the need for animal immunization, delivering:

  • Greater precision in targeting human-specific antigens
  • Reduced immunogenicity and adverse reactions
  • Scalable production in microbial or plant-based systems

These platforms reflect a deeper trust in human biology—designing with it, not against it.


Sample from Stem Cell Science shop

Plant-Based Compounds: Ancient Wisdom Meets Modern Science

Adaptogens are systemic allies. These plant-derived compounds support the body’s ability to adapt to stress, regulate immune responses, and maintain homeostasis. Unlike many pharmaceuticals that target isolated symptoms, adaptogens work holistically, often interacting with multiple pathways to restore balance.

Among many choices in the medicinal garden, some of the most effective adaptogens come from plants that have thrived in extreme environments. Here are some interesting examples:

  • Creosote bush: Survives intense heat and drought, producing powerful antimicrobial resins.
  • Quaking aspen: Withstands freezing temperatures, encoding anti-inflammatory and protective compounds.
  • Sequoia: A symbol of longevity and resilience, with bark and leaf chemistry that resists pathogens and decay.

These plants are survivors and basically immortal — they teach us with their wisdom. Their biochemistry reflects strategies for endurance, regeneration, and ecological harmony.


Sustainable Cultivation: A Modular Approach to Plant-Based Pharma

What makes this shift truly scalable is the ability to cultivate or clone protective compounds from small samples. Using seed material or tissue cultures, researchers can isolate key proteins and adaptogenic molecules—then propagate them in modular, non-extractive lab environments. This minimizes ecological disruption while maximizing accessibility.

For instance, magnesium-binding proteins from sprouts or drought-adapted resins from creosote can be cloned using open-source plant DNA kits and expressed in microbial or plant-based systems. These workflows are efficient, ethical, and aligned with regenerative design principles.

This transcending haphazard interference to attain cultivated stewardship. It trusts the intelligence of the plant, the adaptability of the body, and the ingenuity of modular science.


Systems-Level Shift

This isn’t just a technical upgrade—it’s a philosophical one. It reflects a broader movement toward:

  • Open innovation: Sharing protocols, data, and designs to accelerate collective progress.
  • Ecological realism: Designing with planetary boundaries and microbial agency in mind.
  • Modular scalability: Building systems that can adapt across contexts without compromising integrity.

By integrating human-relevant antibodies and plant-based compounds into regenerative workflows, we’re not just improving medicine—we’re reimagining its foundations.


Closing Invitation

The shift to human and plant-based pharma is already underway—but it needs architects, stewards, and collaborators. Whether you’re a researcher, designer, funder, or policymaker, the invitation is clear: help build the model that makes the old one obsolete.

Medicine should not just treat—it should heal. And healing begins with alignment: between body and biosphere, between science and stewardship.

Author: Sarah is an interdisciplinary researcher, systems designer, and composer whose work bridges environmental engineering, agency of lifeforms, and regenerative design. She develops modular lab protocols and open-source frameworks and designs that honor ecological intelligence and planetary health.

Studio Shangri-La Multimedia & OCTAVES Music Summer Update

  • Shangri-La Cloud Summit
  • Cloudstepping

Recent Studio Shangri-La photography artworks include: Cloudbloom series, Shades Of Green, Out To Sea At Night, Night Music and other previously unpublished nature portraits, The Catbird, Flight Deck, Smoketree Silhouette and Bride’s Feathers.

Other recent works also include symbolist “Carbon Based” and Cubist style “Cool Droplets Colorblock I & II.” In the mixed media category, there is the upcycled and whimsical parallelogram, SHIFT, and the large scale, backlit “Emblems Of Imagination.

Please also keep an eye on the TurningArt and SAATCHI Art catalogs for new art. “Daisy Panel” was recently featured on the SAATCHI Art curator’s list.

In the publishing department, the string quartet “Changing Skies” score became available in July. It’s a modern yet traditional string quartet that is based on tonal clouds, given the topic of different types of clouds, and planetary dynamics, and their majesty.

With OCTAVES Music releases, the summer season saw the release of the Artemis Amenti “Fortune” album and the new Sarah Ikerd “432 Guitar,”respectively alt pop and classical albums.

For the upcoming Grammy season, OCTAVES Music has 3 entries in different genres and, happily, this is the second year of participation in this iconic celebration of music.

In still other news, a few ecotech designs published to ResearchGate, including: Design For A Battery Farm: Biomineral Synthesis & Refinement Of Lithium, Sodium & Magnesium In A Zoned Clay Matrix, Designing Permeable, Self Healing Pavement That Nourishes The Environment, Design For A Carbon Capture Air Filtration Drone With Helicopter Retrofit, and Design For A Modular Optosonic Waste To Water Receptacle. Fortunately, there has been some interest from the US Department of Transportation.

That’s what it’s all about – making a positive impact through creativity.

Design For A Battery Farm: Biomineral Synthesis & Refinement Of Lithium, Sodium & Magnesium In A Zoned Clay Matrix

Design For A Battery Farm: Biomineral Synthesis & Refinement Of Lithium, Sodium & Magnesium In A Zoned Clay Matrix

By Sarah Ikerd, Studio Shangri-La Multimedia, July 2025 

Sarah.ikerd@studio-shangri-la.com

www.studio-shangri-la.com; https://www.researchgate.net/profile/Sarah-Ikerd 

Figure 1: Basic Layout of the Zoned Clay Matrix 

Abstract

In an era of escalating demand for critical minerals, this paper proposes a significant paradigm shift: A biogeologic approach to mineral synthesis that follows the Earth’s natural rock cycle, augmented by microbial catalysts and regenerative design. Rather than extracting minerals prematurely—often at great ecological and human cost, this case study of biosynthetic lithium, sodium and magnesium production explores how lithogenic processes can be accelerated and guided through microbial interventions, enabling the formation of useful materials guided by the templates of natural planetary rhythms. (1)

In using battery materials lithium, sodium and magnesium as focal elements, this multitiered clay matrix design examines the feasibility of synthesizing and refining battery grade minerals by mimicking sedimentary and hydrothermal pathways. This is accelerated by microbial agents capable of selective ion transport, carbonate precipitation, and clay formation. This approach reframes lithium not as a scarcity of extractive mining, but as a mineral that could be cultivated through modular, surface-compatible, biologically informed process. In other words, by non-toxic mineral farming. For the long term, lithium cultivation is not recommended. (2) (3) 

The Earth’s difficulty in yielding certain minerals and their toxicity may reflect a natural boundary, an ecological signal that some substances are not yet ready for use. By respecting these boundaries of the rock cycle, biogeologic synthesis offers a new non-extractive, regenerative ethic for infrastructure, energy, and material science: one that is sustainable, and quite symbiotic. The clay matrix is the probable equivalent of building the microbes luxury apartment communities with all you can eat buffets. 

DCF 1.0

Figure 2: Sedimentation – Wikipedia 

Tri-Zone Matrix Architecture

This system employs a modular, zoned matrix composed of three horizontally layered clay habitats, each optimized for microbial synthesis of a specific ion—sodium, lithium, or magnesium. The sodium zone integrates bentonite for hydrated porosity and halotolerant (salt tolerant) biofilms; the lithium zone blends montmorillonite and vermiculite for cation exchange and sulfide templating; and the magnesium zone combines vermiculite with biochar-infused clay, facilitating buffered precipitation and organic scaffolding. (4) (5)

The matrix functions as a surface-compatible, multi-ion refinement complex that is biologically moderated, non-extractive, and aligned with natural sedimentary logic. The three sections model mimics ecological zoning such as that which occurs at different levels, from riparian corridors, to cave systems, or to elementomes. This is a biomimicry of sedimentary environments, that often exhibit repeated lamellae, and strata of microbes and clay. (6) (7)

Figure 3: Montmorillonite – images from Wikipedia (edited)

Overview Of The 6 Layers

The microbes will flourish in this bio-similar habitat, since biofilms form naturally when there’s layering and buffered interfaces. For ionic optimization, having the spaced synthesis zones reduces saturation and supports multi-step mineral formation. Furthermore, the modularity is easy to keep intact and the stack is also tunable per ion. For instance, Magnesium (Mg) might need more acidic interlayers, Lithium (Li) a tighter spacing, or Sodium (Na) more hydration. (8)

Top Layer: Aerobic Microbial Zone

The top layer is an aerobic or oxygen rich surface zone that is the microbial interface, with light porosity where gas exchange occurs, and it also protects from desiccation. 

Lamellae Spacer 1: Microbial Channels (throughout)      

Horizontal lamella allow diffusion & microbial circulation. These soft clay interlayers protect biofilms. Lamellae prevent compaction, distribute oxygen, and set the staging areas. 

Synthesis Layer 1:

The first ionic templating site with ion-specific clay and specialized microbes initiate templating, precipitation and stabilization. The environment is slightly alkaline, which is optimal for Li⁺, Na⁺, Mg²⁺ templating. (9) 

Lamellae Spacer 2:

Lamellae provide structural reset and hydration balance. They maintain porosity and enable interlayer microbial migration. 

Synthesis Layer 2:

The next synthesis layer is for secondary templating & refinement. Further ion capture occurs, and this layered output may improve purity for refinement. (10) 

Reservoir Layer:

The passive bottom layer is the byproduct collection and anaerobe zone. It is a waste sink, for possible post-treatment or soil reentry.     

Figure 4: Sodium, Lithium, Magnesium – images from Wikipedia (edited)

The Matrix Habitat:

Top Layer, Aerobic Microbial Zone                 

• Montmorillonite-Bentonite blend

• Oxygen-rich environment                                

• Hosts lithium, sodium microbes

  • Light porosity for gas exchange

A bentonite/montmorillonite blend is selected for the top layer across all zones to balance hydration stability, microbial adhesion, and surface ion buffering. Pure bentonite offers excellent swelling and cation exchange, and the blended structure maintains porosity and surface coherence without over saturation—providing an optimal aerobic habitat and gentle ionic interface for halotolerant, sulfide-compatible, and buffered microbial communities alike. (11) (12) 

 Middle Layer, Ion Exchange Zone:                   

• Montmorillonite and vermiculite sheets                   

• Slightly alkaline; optimal for Li⁺, Na⁺, Mg²⁺ templating

  • Microbial templating, mineral stabilization             

Microbial Comfort Channels (throughout):      

•   Horizontal lamella allow diffusion & communication     

  • Soft clay interlayers protect biofilms
  • Montmorillonite                 

Bottom Layer, Passive Reservoir:                   

• Captures byproducts & unrefined ions                   

• Potential anaerobic microbial zone                     

  • Reusable as soil amendment or biosensor              

Each reservoir layer serves as a passive collection zone for refined mineral compounds and microbial byproducts. In the sodium zone, it captures excess Na⁺ and halotolerant biosignatures for reuse or biochemical sensing/monitoring. In the lithium zone, it buffers residual Li⁺ compounds and supports secondary microbial cycling. In the magnesium zone, it stabilizes struvite or MgO precipitates, and byproducts can be repurposed for soil amendment/fertilizer or storage. Across all zones, the reservoir preserves ecological fidelity while enabling controlled harvesting of bio-refined minerals. (13) 

Figure 5: Biochar & Struvite – images from Wikimedia (edited)

Design By Zone (Lithium / Sodium / Magnesium)

Sodium Zone: Halo-tolerant Refinement (Na⁺)

• Top Aerobic Layer                                       

• Lamellae Spacer 1                                        

• Synthesis Layer 1 (Na⁺ templating)                       

• Lamellae Spacer 2                                        

• Synthesis Layer 2                                        

• Reservoir Layer (byproducts and microbial reuse)         

Both synthesis layers in the sodium zone utilize bentonite clay, selected for high montmorillonite content, swelling capacity, and strong affinity for Na⁺ ions. The hydrated, porous structure creates an ideal environment for halotolerant microbes, enabling efficient sodium templating and sustained biofilm activity across both layers.

The reservoir layer in the sodium zone captures residual Na⁺ ions and halotolerant microbial metabolites. Byproducts may include sodium hydroxide (NaOH), sodium carbonate (Na₂CO₃), and trace biosignals such as osmolytes, or extracellular polymers. (14) These compounds reflect successful microbial templating and salt-tolerant metabolic activity. Sodium Hydroxide, though volatile, indicates pH modulation, while mild Sodium Carbonate may form through microbial respiration or buffering. (15) (16) 

While sodium hydroxide may form in trace amounts as a microbial byproduct, the matrix design integrates buffering substrates—such as bentonite clay and vermiculite—to absorb alkalinity and prevent corrosive accumulation. Halo-tolerant microbes like Halomonas elongata, also contribute to localized pH regulation through osmolyte production and ion exchange. Together, these mechanisms preserve surface compatibility and ensure that any sodium derivatives remain ecologically safe and non-toxic. (17) (18)

Lithium Zone: Sulfide-Compatible Refinement (Li⁺)  

• Top Aerobic Layer                                        

• Lamellae Spacer 1                                        

• Synthesis Layer 1 (Li⁺ templating)                       

• Lamellae Spacer 2                                        

• Synthesis Layer 2                                        

• Reservoir Layer (for biosensor output or reentry) 

Each lithium zone incorporates two synthesis layers composed of a montmorillonite and vermiculite blend. The upper layer initiates Li⁺ templating through high cation exchange and microbial adhesion, while the lower layer provides buffered conditions for secondary mineral formation and refinement. This dual-layer structure enhances microbial throughput and supports the sequential capture of lithium compounds with ecological fidelity. (19)

The reservoir layer in the lithium zone captures downstream byproducts of microbial refinement, including residual Li⁺ ions, lithium hydroxide, and lithium sulfide. These compounds reflect successful microbial templating and metabolic activity, with LiOH indicating effective pH modulation and Li₂S suggesting sulfide-rich anaerobic cycling. Chemical or molecular traces may also accumulate, offering great potential for reuse. Together, these outputs mark the completion of refinement and better preserving ecological fidelity within the lithium habitat. (20)

Magnesium Zone: Buffered Clay Habitat (Mg²⁺)           

• Top Aerobic or Buffered Layer                           

• Lamellae Spacer 1                                       

• Synthesis Layer 1 (Mg²⁺ templating)                     

• Lamellae Spacer 2                                       

• Synthesis Layer 2                                       

• Reservoir Layer (useful Struvite or Magnesium Oxide MgO output)

Both synthesis layers in the magnesium zone utilize a blend of vermiculite and biochar. Vermiculite provides high cation exchange capacity and interlayer hydration, supporting Mg²⁺ adsorption and microbial mobility. Biochar enhances porosity, buffers pH, and offers additional surface area for Struvite, a potential fertilizer, or MgO formation. Together, the layers create a breathable, buffered habitat for magnesium-templating microbes such as Proteus mirabilis and Bacillus subtilis, enabling efficient mineral refinement with ecological fidelity. (21)

Figure 6: Ghost Calcite, example of lamellar sedimentation – photo by the author

Sheet-Like Lamellae Spacers

Unlike other designs for clay synthesis, this matrix adds microbes and keeps the geometry horizontal, breathable, and microbe-hospitable. The layered mineral logic allows for naturally encouraged refinement of lithium, sodium, and magnesium. Inspired by nature, it mimics how natural clays (like kaolinite and mica) form layered stacks from interstitial water and ion flow.

Lamellae are mechanically stable; easy to press, mold, or print using common materials with no need for nanofabrication. For microbial comfort, they offer wide surface area for biofilm formation and templating, with no pressure points or harsh vertical compression.

The modularity and scalability ensure that these layers can be added or adjusted based on synthesis needs (such as here lithium, sodium, magnesium), making it versatile without complexity.

Montmorillonite clay is selected as the lamellae spacer material across all matrix zones due to its layered structure, exceptional cation exchange capacity, and microbial compatibility. As a naturally occurring, hydrated silicate, it facilitates horizontal flow, supports microbial adhesion, and maintains stable moisture levels—making it an ideal neutral corridor between synthesis layers without interfering with ion-specific templating. (22)

Figure 7: Atacama, Chile – Wikipedia

The Specialized Microbes

Starting with the remarkable Pseudomonas rhodesiae, it tolerates extraordinary lithium concentrations, and also converts lithium salts into lithium sulfide, using nothing more than cysteine and its own metabolism. The positive implications for current industry here are tremendous. 

Originally isolated from natural mineral waters, especially in lithium-rich environments like the Atacama salt flats, it belongs to the P. fluorescens group, known for thriving in moist, mineral-rich, and slightly alkaline conditions. To perform this biomineralization of lithium sulfide, P. rhodesiae needs lithium salts (lithium chloride or lithium sulfate in solution). Also listed here are the matched microbes for Sodium and Magnesium, which offer less invasive and more earth-friendly ethical alternatives for battery production. (23)

Top Microbe for Sodium (Na⁺): Halomonas elongata

 – Thrives in saline environments and perfect for sodium chloride inputs.

 – Naturally regulates sodium ion transport and osmotic balance.

 – Produces Ectoine, a compatible solute that stabilizes biofilms.

 – It’s matrix synergy works beautifully in hydrated clay layers.

 – It can cohabitate with lithium-templating microbes like P. rhodesiae. (24)

Top Microbe for Lithium (Li⁺): Pseudomonas rhodesiae

– Tolerates extremely high lithium concentrations, up to 700 mM.

  • Produces Hydrogen Sulfide in the presence of Cysteine, an amino acid that helps the bacterium produce H₂S, which reacts with lithium to form Li₂S nanoparticles.

– Moderate temperature, between 20–30°C, and typical of mesophilic bacteria. 

P. rhodesiae prefers aerobic/oxygen-rich environments.

– Neutral to slightly alkaline pH, which is ideal for sulfide production and nanoparticle formation.

Top Microbe for Magnesium (Mg²⁺): Proteus mirabilis

– Ideal for its demonstrated ability to synthesize magnesium oxide nanoparticles extracellularly

– Active in neutral pH (~7), aligning with the matrix’s middle zone.

– Produces enzymes that reduce Mg²⁺ and stabilize mineral output.

– Compatible with montmorillonite and vermiculite layers.

  • Can co-refine magnesium alongside lithium and sodium without competitive inhibition. (25) 

Figure 8: The Microbes – images from Wikipedia (edited)

Source Materials & Interactions

Lithium (Li⁺): Lithium chloride can come from surface brines, which is high energy density for mainstream adoption. P. rhodesiae or L. sphaericus refine this into LiOH or Li₂S, and there is a strong cation exchange via montmorillonite & vermiculite. (26)

Sodium (Na⁺): This is readily available as sodium chloride (NaCl), which is abundant, non-toxic, and low-cost. The halo-tolerant microbes can template Na-based compounds and are compatible with the bentonite and clay hydration layers. 

Magnesium (Mg²⁺): Magnesium sulfate or carbonate minerals are high charge density and stable chemistry. Microbes mediate Mg mineralization (e.g. struvite) while the matrix buffers pH and enables ion accommodation. (27)

By enabling microbial synthesis of lithium alongside sodium and magnesium within the same clay matrix, this design offers an adaptable, modular refinement path—supporting both current demand and more importantly next-generation energy systems. The intent is to open another door to regenerative mineral economy with a concept that’s scaleable. 

Suggested Size For Lab-Scale Prototype

The goal starting parameters for a convincing yield would have to show effective surface-compatible synthesis of Li⁺, Na⁺, and Mg²⁺ at meaningful volume for lab validation or pilot demonstration. These are conservative estimates based on microbial throughput, ion diffusion rates, and realistic surface-compatible yields; scaling up is modular, expanding each layered zone independently: 

Matrix footprint: 45 cm × 15 cm × 5 cm 

Total yield: 0.5–1.0 g/day across three elements

Zone < Dimensions < Volume < Clay Mass (wet) < Target Output 

Sodium: ~15 × 15 × 5 cm, ~1.1 L, ~1.2 kg, ~300–500 mg Na per day 

Lithium: ~15 × 15 × 5 cm, ~1.1 L, ~1.3 kg, ~50–150 mg  

Magnesium: ~15 × 15 × 5 cm, ~1.1 L, ~1.1 kg, ~150–300 mg 

Even this demonstration scale could provide real-world relevance without extractive pressure. It also provides enough material for spectroscopy, structural analysis and perhaps even battery prototype testing. (28)

Figure 9: Microsoft Copilot AI visualization of the Biorefinery

Field-Ready Biorefinery Model

The tri-zone clay matrix for refining lithium, sodium, and magnesium is very well suited for distributed deployment as a field-scale biorefinery. (29) For containment, a cellulose bioplastic is recommended for each matrix unit. (30) Here’s how it can translate to larger scale: 

Modular Arrays

– Each unit is ~45 × 15 × 5 cm and self-contained.

– Arrays of 10–100 units can be deployed in greenhouses, rooftops and more.

– Units are stackable or spreadable, depending on terrain and climate.

Surface-Compatible Operation

– No excavation, no toxic solvents, no extractive pressure.

– Uses ambient hydration, passive flow, and microbial inoculation.

– Can be powered by solar-heated water, rain-fed systems or gravity-fed brine inputs.

Microbial Refinement Zones

– Sodium zone: Halomonas elongata in bentonite-rich lamellae.

– Lithium zone: P. rhodesiae and L. sphaericus in montmorillonite/vermiculite blend.

– Magnesium zone: Proteus mirabilis and B. subtilis in biochar-infused vermiculite. (31)

Possible Large Scale Yield Of Minerals

Based on the above information, a 100-unit array could produce ~50–100 g/day of refined ion compounds. That is enough for battery prototyping, material testing, or regional supply chains. Lithium is presented here, since it has been an industry standard. However, sodium and magnesium based batteries are also here presented as possibly more non toxic and ethical alternatives, in addition to others. (32)

Conclusion 

Guided by microbial intelligence, this design harnesses the innate capability of Earth’s earliest engineers. With future directions that could even include terraforming, this process-based design represents a biorefinery that is a living mineral farm. It’s deployable, ethical, and revolutionary — an architecture of stewardship and synthesis. This layered clay matrix, guided by specialized microbes, refines sodium, lithium, and magnesium with ecological fidelity and it also nourishes the soil through beneficial byproducts like struvite and magnesium oxide, returning value to the Earth. Such symbiotic logic could reshape mineral sourcing for good. After all, nature is working for us and not against us, and we can do the same.

References

1. Rudko, G. (2022). Scientific and Methodological Foundations of Biogeology. In: Chenchouni, H., et al.New Prospects in Environmental Geosciences and Hydrogeosciences. CAJG 2019. Advances in Science, Technology & Innovation. Springer, Cham. https://doi.org/10.1007/978-3-030-72543-3_21

2. Biemolt J, Jungbacker P, van Teijlingen T, Yan N, Rothenberg G. Beyond Lithium-Based Batteries. Materials (Basel). 2020 Jan 16;13(2):425. doi: 10.3390/ma13020425. PMID: 31963257; PMCID: PMC7013668.

3. Marwa Eltarahony, Daniel Jestrzemski, Mohamed A. Hassan,

A comprehensive review of recent advancements in microbial-induced mineralization: biosynthesis and mechanism, with potential implementation in various environmental, engineering, and medical sectors,

Science of The Total Environment, Volume 978, 2025, 179426, ISSN 0048-9697, https://doi.org/10.1016/j.scitotenv.2025.179426.

(https://www.sciencedirect.com/science/article/pii/S0048969725010630)

4. Behnsen, J., and D. R. Faulkner (2013),  Permeability and frictional strength of cation-exchanged montmorillonite, J. Geophys. Res. Solid Earth,  118,  2788–2798, doi:10.1002/jgrb.50226.

5. Emily Millman, Anamika Chatterjee, Kimberly M. Parker, Jeffrey G. Catalano, Cation exchange to montmorillonite induces selective adsorption of amino acids, Geochimica et Cosmochimica Acta, Volume 372, 2024,

Pages 181-195, ISSN 0016-7037, https://doi.org/10.1016/j.gca.2024.02.020. (https://www.sciencedirect.com/science/article/pii/S0016703724001029)

6. Di Zhang, Chun-Hui Zhou, Chun-Xiang Lin, Dong-Shen Tong, Wei-Hua Yu, Synthesis of clay minerals, Applied Clay Science, Volume 50, Issue 1,

2010, Pages 1-11, ISSN 0169-1317, https://doi.org/10.1016/j.clay.2010.06.019. (https://www.sciencedirect.com/science/article/pii/S016913171000181X)

7. Kemmling, A., Kämper, M., Flies, C. et al. Biofilms and extracellular matrices on geomaterials. Env Geol46, 429–435 (2004). https://doi.org/10.1007/s00254-004-1044-x

8. Microbes as Structural Templates in Biofabrication: Study of Surface Chemistry and Applications. Muhammad Wajid Ullah, Zhijun Shi, Xudian Shi, Di Zeng, Sixiang Li, and Guang Yang. ACS Sustainable Chemistry & Engineering 2017 5 (12), 11163-11175, DOI: 10.1021/acssuschemeng.7b02765. 

9. Debnath, A., Mitra, S., Ghosh, S. et al. Understanding microbial biomineralization at the molecular level: recent advances. World J Microbiol Biotechnol 40, 320 (2024). https://doi.org/10.1007/s11274-024-04132-6

10. Gui Li Li, Chun Hui Zhou, Saverio Fiore, Wei Hua Yu,

Interactions between microorganisms and clay minerals: New insights and broader applications, Applied Clay Science, Volume 177, 2019, Pages 91-113, ISSN 0169-1317, https://doi.org/10.1016/j.clay.2019.04.025.

(https://www.sciencedirect.com/science/article/pii/S0169131719301565)

11. Zhang, C., Zhou, K., Wang, Z. et al. Montmorillonite as an “accelerator” for the microbial carbon pump during artificial biocrust construction. Plant Soil (2025). https://doi.org/10.1007/s11104-025-07256-2

12. Endo, M., & Sato, H. (2024). Swelling Stress of Bentonite: Thermodynamics of Interlayer Water in K-Montmorillonite in Consideration of Alteration. Minerals, 14(4), 430. https://doi.org/10.3390/min14040430

13. Bamdad, H.,  Papari, S.,  Lazarovits, G., &  Berruti, F. (2022).  Soil amendments for sustainable agriculture: Microbial organic fertilizers. Soil Use and Management,  38,  94–120. https://doi.org/10.1111/sum.12762

14. Mojtabavi S, Samadi N, Faramarzi MA. Osmolyte-Induced Folding and Stability of Proteins: Concepts and Characterization. Iran J Pharm Res. 2019 Fall;18(Suppl1):13-30. doi: 10.22037/ijpr.2020.112621.13857. PMID: 32802087; PMCID: PMC7393045.

15. Ahmadi, Majid & Seyedina, Seyed. (2019). Investigation of NaOH Properties, Production and Sale Mark in the world. https://www.researchgate.net/publication/337495070_Investigation_of_NaOH_Properties_Production_and_Sale_Mark_in_the_world 

16. Brooke D, Movahed N, Bothner B. Universal buffers for use in biochemistry and biophysical experiments. AIMS Biophys. 2015;2(3):336-342. doi: 10.3934/biophy.2015.3.336. Epub 2015 Aug 14. PMID: 35340547; PMCID: PMC8956001.

17. Robles-Fernández, A., Areias, C., Daffonchio, D., Vahrenkamp, V. C., & Sánchez-Román, M. (2022). The Role of Microorganisms in the Nucleation of Carbonates, Environmental Implications and Applications. Minerals, 12(12), 1562. https://doi.org/10.3390/min12121562

18. Indrasumunar A, Gresshoff PM. Vermiculite’s strong buffer capacity renders it unsuitable for studies of acidity on soybean (Glycine max L.) nodulation and growth. BMC Res Notes. 2013 Nov 14;6:465. doi: 10.1186/1756-0500-6-465. PMID: 24229409; PMCID: PMC3835622.

19. Xiaojuan Lu, Mingyang Duan, Jing Li,

Increase of the ionic conductivity of perovskite-type lithium-ion conductor by bacterial cellulose templating, Ceramics International, Volume 49, Issue 15,

2023, Pages 24981-24988, ISSN 0272-8842, https://doi.org/10.1016/j.ceramint.2023.05.027. (https://www.sciencedirect.com/science/article/pii/S0272884223012737)

20. Junhyeong- Seo, Thang Toan Vu, Seungu- Cho, Jieun- Cha, Yeongeun- Choi, Hojung- Kim, Daesung- Song. Techno-economic evaluation of Lithium hydroxide recovery from waste battery effluent: Process design and scalability assessment,

Journal of Energy Storage, Volume 125, 2025, 117002, ISSN 2352-152X,

https://doi.org/10.1016/j.est.2025.117002.(https://www.sciencedirect.com/science/article/pii/S2352152X25017153)

21. Ma, Z., Zheng, D., Liang, B. et al. Effect of vermiculite-modified biochar on carbon sequestration potential, mercury adsorption stability, and economics. Biomass Conv. Bioref. 15, 9513–9529 (2025). https://doi.org/10.1007/s13399-024-05774-0

22. Wenbo Wang, Yunliang Zhao, Licai Chen, Lingjie Zhang, Tong Wen, Zhenlei Wang, Tingting Zhang. Two-dimensional montmorillonite membranes with controllable sub-nanochannel for precise separation of mono/divalent cations.

Chemical Engineering Journal, Volume 500, 2024, 156801, ISSN 1385-8947,

https://doi.org/10.1016/j.cej.2024.156801. (https://www.sciencedirect.com/science/article/pii/S1385894724082925)

23. Bruna, N., Galliani, E., Oyarzún, P. et al. Biomineralization of lithium nanoparticles by Li-resistant Pseudomonas rodhesiae isolated from the Atacama salt flat. Biol Res 55, 12 (2022). https://doi.org/10.1186/s40659-022-00382-6

24. Hobmeier Karina , Goëss Marie C. , Sehr Christiana , Schwaminger Sebastian , Berensmeier Sonja , Kremling Andreas , Kunte Hans Jörg , Pflüger-Grau Katharina , Marin-Sanguino Alberto. Anaplerotic Pathways in Halomonas elongata: The Role of the Sodium Gradient. Frontiers in Microbiology, Volume 11, 2020. https://www.frontiersin.org/journals/microbiology/articles/10.3389/fmicb.2020.561800. DOI=10.3389/fmicb.2020.561800. ISSN=1664-302X. 

25. Iqtedar, M., Arooj, S., Shahzad, A. et al. Proteus mirabilis—Mediated Green Synthesis of Magnesium Nanoparticles: Optimization and Their Antimicrobial Activity. Biol Bull Russ Acad Sci 51, 1605–1613 (2024). https://doi.org/10.1134/S1062359024608449

26. Microbial Mineralization with Lysinibacillus sphaericus for Selective Lithium Nanoparticle Extraction. Toriana N. Vigil, Grayson C. Johnson, Sarah G. Jacob, Leah C. Spangler, and Bryan W. Berger. Environmental Science & Technology 2024 58 (38), 16915-16921. DOI: 10.1021/acs.est.4c06540. 

27. Cho, T., & Kim, M. J. (2018). Synthesis of magnesium sulfate from seawater using alkaline industrial wastes, sulfuric acid, and organic solvents. Separation Science and Technology, 54(16), 2749–2757. https://doi.org/10.1080/01496395.2018.1553982

28. Cleaver, J. (2023, October 26). *Rules of thumb: Scale-up*. The Chemical Engineer. https://www.thechemicalengineer.com/features/rules-of-thumb-scale-up/

29. Calvo-Flores Francisco G., Martin-Martinez Francisco J. Biorefineries: Achievements and challenges for a bio-based economy. Frontiers in Chemistry, Volume 10 – 2022, https://www.frontiersin.org/journals/chemistry/articles/10.3389/fchem.2022.973417, DOI=10.3389/fchem.2022.973417, ISSN=2296-2646.

30. Nigam, S., Das, A.K., Matkawala, F. et al. An insight overview of bioplastics produced from cellulose extracted from plant material, its applications and degradation. Environmental Sustainability 5, 423–441 (2022). https://doi.org/10.1007/s42398-022-00248-3

31. Guo, T., & Herman, J. K. (2023). *Magnesium modulates Bacillus subtilis cell division frequency*. *Journal of Bacteriology, 205*(1), e00375-22. https://doi.org/10.1128/jb.00375-22

32. F. N. Crespilho,  C. M. Costa,  S. Lanceros-Méndez, ChemElectroChem  2025,  12, e202400530. https://doi.org/10.1002/celc.202400530